| Cata #: | Name of Product: | Price: |
| HRP-0773 | Recombinant Human PPIE Protein | $300 |

| Product Name: | Recombinant Human PPIE Protein |
| Catalog #: | HRP-0773 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human peptidyl-prolyl cis-trans isomerase E (PPIE) gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities, and it also exhibits RNA-binding activity. Recent data indicated that PPIE specifically interactive with MLL to regulate H3K4me3 activity for down-stream gene transcription activation or repression switch. Full-length human PPIE (301aa, isoform_1) gene was constructed with 15aa N-terminal T7 tag and expressed in E.coli as inclusion bodies, refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | PPIE (CYP-33; CYP33) |
| Accession Number: | NP_006103 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Park,S.,et al., The PHD3 domain of MLL acts as a CYP33-regulated switch between MLL-mediated activation and repression. Biochemistry 49 (31), 6576-6586 (2010)
Hom,R.A., et al., Molecular mechanism of MLL PHD3 and RNA recognition by the Cyp33 RRM domain. J. Mol. Biol. 400 (2), 145-154 (2010) Wang,Z., et al., Pro isomerization in MLL1 PHD3-bromo cassette connects H3K4me readout to CyP33 and HDAC-mediated repression. Cell 141 (7), 1183-1194 (2010) |
| Applications: | 1. May be used for in vitro MLL/H3K4me3 gene transcription activation regulation study with intracellular protein delivery of this protein. 2. As soluble/native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay or RNA binding assay development. 3. May be used for mapping MLL/H3K4me3 protein–protein interaction assay development. 4. May be used as antigen for specific antibody development and potential cancer diagnostic development. |
| Quality Control: | 1. Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV Download Datasheet |