| Cata #: | Name of Product: | Price: |
| HRP-0850 | Recombinant Human PIN1 Protein | $250 |

| Product Name: | Recombinant Human PIN1 Protein |
| Catalog #: | HRP-0850 |
| Manufacture: | LD Biopharma, Inc. |
| Introduction: | Human Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. Human PIN1 gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene. |
| Gene Symbol: | PIN1 ( DOD; UBL5 ) |
| Accession Number: | NP_006212 |
| Species: | Human |
| Package Size: | 20 μg / Vial |
| Composition: | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT and other. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Lu,K.P., et al., A human peptidyl-prolyl isomerase essential for regulation of Mitosis. Nature 380 (6574), 544-547 (1996) |
| Applications: |
|
| Quality Control: | Purity: > 92 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQ GEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDC SSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |