Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| BRP-4335 | Recombinant sfGFP-Protein L Fusion Protein | $250 |
| Product Name: | Recombinant sfGFP-Protein L Fusion Protein |
| Catalog #: | BRP-4335 |
| Manufacture: | LD Biopharma, Inc. |
| Introduction: | Protein L, isolated from the surface of the bacterial species Peptostreptococcus magnus, is known to bind immunoglobulins through interactions with the light (L) chain. Unlike Protein A or G, Protein L exhibits a broader binding range, interacting with representatives of all antibody classes, including IgG, IgM, IgA, IgE, and IgD. Additionally, it also binds to single-chain variable fragments (scFv) and Fab fragments. To enhance the monitoring of Protein L's antibody-binding capacity, superGFP was fused to Protein L, creating a fusion protein that facilitates easy detection. Protein-L-Linker-SuperGFP fusion protein cDNA was constructed with codon optimization gene synthesis and expressed with a human N-terminal His Tag (8aa) fusion. This protein was expressed in E. coli as soluble protein. The final product was afiinity/chromatographically purified. |
| Gene Symbol: | sfGFP -Protein-L |
| Accession Number: | ASL68970 + AAA25612 |
| Species: | Synthetic |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20% glycerol / PBS buffer |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Pédelacq J-D, et al., Engineering and characterization of a superfolder green fluorescent protein. Nature Biotechnology, 24(1), 79-88. doi: 10.1038/nbt1172 (2005) Kastern,W.,et al., Structure of peptostreptococcal protein L and identification of a repeated immunoglobulin light chain-binding domain. J. Biol. Chem. 267 (18), 12820-12825 (1992) Zhili Zheng, et al. Protein L: a novel reagent for the detection of Chimeric Antigen Receptor (CAR) expression by flow cytometry. Journal of Translational Medicine volume 10, Article number: 29 (2012) |
| Applications: | May be used for in vitro antibody mediated assay, such as detection of scFv on CAR-T cell using flow-cytometry with Protein-L-sfGFP fusion protein or live staining using GFP for monitoring stem cell differentiation. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MKHHHHHHQVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKSGLRSGGSGGENLYFQGSEETPETPETDSEEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADALKKDNGEYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFEEATAEAYRYADLLAKENGKYTVDVADKGYTLNIKFAGKEKTPEEPKEEVTIKANLIYADGKTQTAEFKGTFAEATAEAYRYADLLAKENGKYTADLEDGGYTINIRFAGKKVDEKPEEKEQVTIKENIYFEDGTVQTATFKGTFAEATAEAYRYADLLSKEHGKYTADLEDGGYTINIRFAG |