Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-4374 | Recombinant sfGFP-Human Feimin Fusion Protein | $250 |
| Product Name: | Recombinant sfGFP-Human Feimin Fusion Protein |
| Catalog #: | HRP-4374 |
| Manufacture: | LD Biopharma, Inc. |
| Introduction: | The human C5orf24 gene encodes a 188-amino acid protein, which has recently been shown to play a critical role in exercise performance. Research demonstrates that the C5orf24 protein was mainly produced in myocytes, which can be phosphorylated and activated by AMPK during exercise. This activation enhances exercise performance by suppressing muscle thermogenesis. Due to its functional significance, the C5orf24 protein has been renamed Feimin. Upon phosphorylation, Feimin undergoes nuclear translocation, where it binds to FOXC2. This interaction leads to the inhibition of Sln transcription, which subsequently promotes Ca2+ reuptake into the sarcoplasmic reticulum (SR). As a result, heat production is reduced, and exercise performance is enhanced. This mechanism highlights Feimin's pivotal role in regulating muscle function and energy efficiency during physical activity. Full-length human Feimin cDNA (187aa) was constructed with codon optimization gene synthesis and expressed with a SuperGFP protein at N-terminal (sfGFP; 257aa) as fusion protein The final product was expressed as soluble protein and affinity-chromatographically purified. |
| Gene Symbol: | Feimin ( C5orf24 ) |
| Accession Number: | NP_689622 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20% Glycerol + PBS buffer |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Ying Peng, et al., Cellular Feimin enhances exercise performance by suppressing muscle thermogenesis. Nature metabolism. (2025) https://doi.org/10.1038/s42255-024-01176-8 |
| Applications: |
|
| Quality Control: | Purity: > 85 % by SDS-PAGE. sfGFP protein: Ex λ = 485nm, and Em λ = 510nm. |
| Recombinant Protein Sequence: | MKHHHHHHQVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKSGLRSGGSGGENLYFQGSEFMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETSSEVKPPNE |