| Cata #: | Name of Product: | Price: |
| HRP-3964 | Recombinant sfGFP- Human CYTA Fusion Protein | $200 |

| Product Name: | Recombinant sfGFP- Human CYTA Fusion Protein |
| Catalog #: | HRP-3964 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human cystatin-A (CYTA) gene encodes an intracellular thiol proteinase inhibitor. CYTA mainly expressed in the skin throughout the epidermis. It has an important role in desmosome-mediated cell-cell adhesion in the lower levels of the epidermis. Recent data demonstrated that CYTA as an epidermally derived hormone linking skin aging to age-related bone loss. Enhancers of skin CYTA levels could serve as a potential topical drug for treatment of senile osteoporosis.
|
| Gene Symbol: | CYTA ( CSTA; STFA; STF1 ) |
| Accession Number: | NP_005204 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile filtered, in PBS buffer with 20% Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Wenquan Liang, et al., Skin chronological aging drives age-related bone loss via secretion of cystatin-A. Nature Aging. Vol 2, 906-922.(2022). doi.org/10.1038/s43587-022-00285-x Wang Y, et al., Decreased CSTA expression promotes lymphatic metastasis and predicts poor survival in oral squamous cell carcinoma. Arch Oral Biol 126, 105116 (2021) Dohm A, et al.,Identification of CD37, cystatin A, and IL-23A gene expression in association with brain metastasis: analysis of a prospective trial. Int J Biol Markers 34 (1), 90-97 (2019) |
| Applications: |
|
| Quality Control: | Purity: > 95 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MKHHHHHHQVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKSGLRSGGSGGENLYFQGIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF |