Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-3671 | Recombinant YFP-Human IRGM Protein | $300 |
| Product Name: | Recombinant YFP-Human IRGM Protein |
| Catalog #: | HRP-3671 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human Immunity-related GTPase family M protein (IRGM) encodes a putative GTPase which is required for clearance of acute protozoan and bacterial infections. IRGM functions in innate immune response probably through regulation of autophagy. It may regulate pro-inflammatory cytokine production and prevent endotoxemia upon infection. It may also play a role in macrophages adhesion and motility. Full-length human IRGM cDNA (180aa) was constructed with codon optimization gene synthesis and expressed with YFP Protein as N-terminal (YFP; 256aa) fusion protein in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | IRGM ( IFI1; IRGM1; LRG47 ) |
| Accession Number: | NP_001139277.1 |
| Species: | Human |
| Package Size: | 50µg / Vial |
| Composition: | 0.5mg / ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT and others. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Fang S, et al., IRGM/Irgm1 facilitates macrophage apoptosis through ROS generationand MAPK signal transduction: Irgm1 (+/-) mice display increasesatherosclerotic plaque stability. Theranostics 11 (19), 9358-9375 (2021) Tan YQ, et al., Interferon-gamma activated T-cell IRGM-autophagy axis in oral lichen planus. Int Immunopharmacol 94, 107478 (2021) Guo X, et al.,IRGM promotes the PINK1-mediated mitophagy through the degradationof Mitofilin in SH-SY5Y cells. FASEB J 34 (11), 14768-14779 (2020) |
| Applications: |
|
| Quality Control: | |
| Recombinant Protein Sequence: | MKHHHHHHQVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLLCTTGKLPVPWPTLVTTLGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALFKDPNEKRDHMVLLEFLTAAGITEGMNELYKGSEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY |