Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| VRP-3455 | Recombinant YFP-HBxAg Fusion Protein | $250 |
| Product Name: | Recombinant YFP-HBxAg Fusion Protein |
| Catalog #: | VRP-3455 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | HBxAg gene encodes a 17-kDa viral protein that plays an essential role in the HBV replication cycle. It was recently determined that a key function of HBxAg is to promote the degradation of the cellular structural maintenance of chromosomes 5/6 complex (Smc5/6). Smc5/6 directly binds DNA, and has been shown to topologically entrap DNA plasmids. As such, HBxAg is a potential therapeutic target since it promotes the degradation of the hepatocyte Smc5/6 complex that inhibits HBV transcription. Full-length HBxAg cDNA (153aa, derived from Adw2 subtype) was constructed with codon optimization gene synthesis and expressed with YFP protein as N-terminal (YFP; 256aa) fusion partner in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | HBxAg |
| Accession Number: | AAK97176.1 |
| Species: | Viral |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT and others. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Mark Feitelson, et al.Hepatitis B virus x antigen in the pathogenesis of chronic infections and the development of HCC. American Journal Of Pathology 150(4):1141-57. (1997) Kornyeyev D, et al.,Spatiotemporal analysis of hepatitis B virus X protein in primary human hepatocytes. J Virol 93:e00248-19. https://doi.org/10.1128/JVI.00248-19.( 2019) Decorsiere A,et al., Hepatitis B virus X protein identifies the Smc5/6 complex as a host restriction factor. Nature 531:386 –389. https://doi.org/10.1038/nature17170.(2016) |
| Applications: |
|
| Quality Control: | Purity: > 92 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MKHHHHHHQVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLLCTTGKLPVPWPTLVTTLGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALFKDPNEKRDHMVLLEFLTAAGITEGMNELYKGSENLYFQGEFAARLYCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPADHGAHLSLRRLPVCAFSSAGPCTLRFTSARCMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA |