Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-3440 | Recombinant YFP-Human KPTN Protein | $300 |
| Product Name: | Recombinant YFP-Human KPTN Protein |
| Catalog #: | HRP-3440 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human KICSTOR complex protein kaptin (KPTN) gene encodes a protein which is part of the KICSTOR complex functions in the amino acid-sensing branch of the TORC1 signaling pathway. Recruits, in an amino acid-independent manner, the GATOR1 complex to the lysosomal membranes and allows its interaction with GATOR2 and the RAG GTPases. KPTN functions upstream of the RAG GTPases and is required to negatively regulate mTORC1 signaling in absence of amino acids. In absence of the KICSTOR complex mTORC1 is constitutively localized to the lysosome and activated. The KICSTOR complex is also probably involved in the regulation of mTORC1 by glucose. Full-length human KPTN cDNA (435aa, Isoform-I) was constructed with codon optimization gene synthesis and expressed with YFP Protein as N-terminal (YFP; 256aa) fusion protein in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | KPTN |
| Accession Number: | NP_008990 |
| Species: | Human |
| Package Size: | 75µg / Vial |
| Composition: | 1.5mg / ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT and others. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Pacio Miguez M,et al.,Pathogenic variants in KPTN, a rare cause of macrocephaly andintellectual disability. Am J Med Genet A 182 (10), 2222-2225 (2020 Wolfson RL, et al., KICSTOR recruits GATOR1 to the lysosome and is necessary fornutrients to regulate mTORC1.Nature 543 (7645), 438-442 (2017) Baple EL, et al., Mutations in KPTN cause macrocephaly, neurodevelopmental delay, andseizures. Am J Hum Genet 94 (1), 87-94 (2014) |
| Applications: |
|
| Quality Control: | Purity: > 92 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MKHHHHHHQVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLLCTTGKLPVPWPTLVTTLGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALFKDPNEKRDHMVLLEFLTAAGITEGMNELYKGSENLYFQGEFMGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVLGFRYQDLRQKIRPVAKELQFNYIPVDAEIVSIDTFNKSPPKRGLVVGITFIKDSGDKGSPFLNIYCDYEPGSEYNLDSIAQSCLNLELQFTPFQLCHAEVQVGDQLETVFLLSGNDPAIHLYKENEGLHQFEEQPVENLFPELTNLTSSVLWLDVHNFPGTSRRLSALGCQSGYVRVAHVDQRSREVLQMWSVLQDGPISRVIVFSLSAAKETKDRPLQDEYSVLVASMLEPAVVYRDLLNRGLEDQLLLPGSDQFDSVLCSLVTDVDLDGRPEVLVATYGQELLCYKYRGPESGLPEAQHGFHLLWQRSFSSPLLAMAHVDLTGDGLQELAVVSLKGVHILQHSLIQASELVLTRLRHQVEQRRRRLQGLEDGAGAGPAENAAS |