Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-3302 | Recombinant sfGFP-Human MBL2 Fusion Protein | $250 |
| Product Name: | Recombinant sfGFP-Human MBL2 Fusion Protein |
| Catalog #: | HRP-3302 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human Mannose-Binding Protein C (MBL2) gene encodes a secreted protein which is calcium-dependent lectin involved in innate immune defense. It binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. MBL2 also binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. It may bind DNA. Recent data indicated that various tumor cells carry aberrant glycosylated proteins on cell surface, such as uncapped N-acetyl-glucosamine and mannose, which can be captured using MBL2 as affinity-binding reagents. As such, flurescence labeled MBL2 (superGFP) may also be a good detection reagents for CTC assay. Full-length secreted form of human MBL2 cDNA (21-248aa) was constructed with codon optimization gene synthesis and expressed with a SuperGFP Protein N-terminal (sGFP; 257aa) fusion at target protein N-terminal in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | MBL2 (COLEC1; MBL; Collectin-1) |
| Accession Number: | NP_000233.1 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -20°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Joo H Kang, et al., An Engineered Human Fc-Mannose-Binding Lectin Captures Circulating Tumor Cells. Advanced Biosystems.(2017). DOI: 10.1002/adbi.201700094 Andreia Peixoto, et al., Protein Glycosylation and Tumor Microenviroment alternation Driving Cancer Hallmarks. Fron. Oncol., 14 May.(2019). doi.org/10.3389/fonc.2019.00380 |
| Applications: |
|
| Quality Control: | Purity: > 93 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MKHHHHHHQVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKSGLRSGGSGGENLYFQGSGGGGSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI |