Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HTF-1495 | Recombinant Human CDX2 Protein | $300 |
| Product Name: | Recombinant Human CDX2 Protein |
| Catalog #: | HTF-1495 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human homeobox protein CDX2 gene encodes a transcription factor, which is involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. It plays an important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine. CDX2 binds preferentially to methylated DNA. Full-length human CDX2 cDNA (312aa, derived from BC014461) was constructed with codon optimization using gene synthesis technology and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. It was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CDX2 ( CDX2/AS; CDX3 ) |
| Accession Number: | NP_001256.4 |
| Species: | Human |
| Package Size: | 20 µg / Vial |
| Composition: | 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT & others. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Junhui Yu., et al.,CDX2 inhibits the proliferation and tumor formation of colon cancer cells by suppressing Wnt/β-catenin signaling via transactivation of GSK-3β and Axin2 expression. Cell Death Dis. Jan 10;10(1): 26.(2019) |
| Applications: |
|
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ |