Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal

Our Products

Home > Products

Cata #: Name of Product: Price:
HTF-2085 Recombinant Human HNF1α Protein $300
img

Recombinant Human HNF1α Protein

Product Name: Recombinant Human HNF1α Protein
Catalog #:  HTF-2085
Manufacture:  LD Biopharma, Inc.
Intruduction:

Human hepatocyte nuclear factor 1-alpha (HNF1a) gene encodes a transcriptional activator that regulates the tissue specific expression of multiple genes, especially in pancreatic islet cells and in liver. HNF1α binds to the inverted palindrome 5'-GTTAATNATTAAC-3'. It activates the transcription of CYP1A2, CYP2E1 and CYP3A11. 

Full-length human HNF1α cDNA (630aa, derived from BC104908) was constructed with codon optimization using gene synthesis technology and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. It was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.

Gene Symbol:  HNF1α ( TCF1; LFB1 ) 
Accession Number:  NP_000536
Species:  Human
Package Size:  50 µg / Vial   
Composition: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT & others.
Storage: In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks.
Key Reference:

Lu Y, et al., HNF1A inhibition induces the resistance of pancreatic cancer cells to gemcitabine by targeting ABCB1. EBioMedicine 44, 403-418 (2019)

Abel EV, et al., HNF1a is a novel oncogene that regulates human pancreatic cancer stem cell properties. Elife. Aug 3:7:e33947 (2018)

Szpirer C, et al., Chromosomal localization in man and rat of the genes encoding theliver-enriched transcription factors C/EBP, DBP, and HNF1/LFB-1

(CEBP, DBP, and transcription factor 1, TCF1, respectively) and of the hepatocyte growth factor/scatter factor gene (HGF). Genomics 13 (2), 293-300 (1992)

Applications:
  1. May be used for in vitro HNF1α mediated gene transcription regulation study for hepatocytes differentiation by intracellular delivery of this recombinant HNF1α protein with protein delivery reagent such as ProFectin reagent kit. 
  2. May be used for mapping HNF1α protein-protein interaction.
  3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays.
  4. As native human HNF1α immunogen for specific antibody production.
Quality Control: Purity: > 85 % by SDS-PAGE.
Recombinant Protein Sequence:

MASMTGGQQMGRGHHHHHHENLYFQGGEFVSKLSQLQTELLAALLESGLSKEALIQALGEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRHKLAMDTYSGPPPGPGPGPALPAHSSPGLPPPALSPSKVHGVRYGQPATSETAEVPSSSGGPLVTVSTPLHQVSPTGLEPSHSLLSTEAKLVSAAGGPLPPVSTLTALHSLEQTSPGLNQQPQNLIMASLPGVMTIGPGEPA
SLGPTFTNTGASTLVIGLASTQAQSVPVINSMGSSLTTLQPVQFSQPLHPSYQQPLMPPVQSHVTQSPFMATMAQLQSPHALYSHKPEVAQYTHTGLLPQTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPSQDPAGIQHLQPAHRLSASPTVSSSSLVLYQSSDSSNGQSHLLPSNHSVIETFISTQMASSSQ

Download Datasheet