Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| VRP-3077 | Recombinant sfGFP-SARS-CoV-2 ORF10 Fusion Protein | $150 |
| Product Name: | Recombinant sfGFP-SARS-CoV-2 ORF10 Fusion Protein |
| Catalog #: | VRP-3077 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Coronaviruses are a group of enveloped positive-stranded RNA viruses that consist of four structural proteins including spike (S) glycoprotein, envelope (E) protein, membrane (M) protein, and nucleocapsid (N) protein. The Orf10 of SARS-CoV is 38aa protein which may hijack host cell ubiquitination pathways for replication and pathogenesis. The novel Orf10 of SARS-CoV-2 interacts with members of a Cullin 2 (CUL2) RING E3 ligase complex, specifically the CUL2ZYG11B complex. Full-length SARS-coV2 viral ORF10 cDNA (37aa) was constructed with codon optimization gene synthesis and expressed with a SuperGFP Protein N-terminal (sfGFP; 257aa) fusion at target protein N-terminal in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | SARS-Cov2 ORF10 |
| Accession Number: | QHI42199.1 |
| Species: | Coronovirus |
| Package Size: | 30 µg / Vial |
| Composition: | 0.3 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT and others. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Davld E. Gordon.et al., A SARS-CoV-2 protein interaction map reveals targets for drug repurposing. Nature https://doi.org/10.1038/s41586-020-2286-9 (2020) Wu, F. et al., 2020: A new coronavirus associated with human respiratory disease in China. Nature 579(7798): 265-269. |
| Applications: |
|
| Quality Control: |
|
| Recombinant Protein Sequence: | MKHHHHHHQVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKSGLRSGGSGGGEGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT |