Human pre-B-cell leukemia transcription Factor 1 (PBX1) gene encodes a nuclear protein that belongs to the PBX homeobox family of transcriptional factors. It binds the sequence 5'-ATCAATCAA-3'. PBX1 acts as a transcriptional activator of PF4 in complex with MEIS1. It converted into a potent transcriptional activator by the (1;19) translocation. PBX1 may have a role in steroidogenesis and, subsequently, sexual development and differentiation. Isoform PBXb1 as part of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells is involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element. Probably in complex with MEIS2, is involved in transcriptional regulation by KLF4. PBX1 acts as a transcriptional activator of NKX2-5 and a transcriptional repressor of CDKN2B. Together with NKX2-5, it is required for spleen development through a mechanism that involves CDKN2B repression. 

Full-length human PBX1 cDNA (429aa. Isoform-1) was constructed with codon optimization using gene synthesis technology and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.

PBX1                   ( CAKUHED )  

Golonzhka O, et al., Pbx Regulates Patterning of the Cerebral Cortex in Progenitors andPostmitotic Neurons. Neuron 88 (6), 1192-1207 (2015)

AUFeng Y, et al., Hematopoietic pre-B cell leukemia transcription factor interactingprotein is overexpressed in gastric cancer and promotes gastriccancer cell proliferation, migration, and invasion

Cancer Sci. 106 (10), 1313-1322 (2015)

Magnani L, et al., The pioneer factor PBX1 is a novel driver of metastatic progressionin ERalpha-positive breast cancer. Oncotarget 6 (26), 21878-21891 (2015)

Shen-Hao Chao, et al., Identification of hemeodomain proteins, PBX1 and PREP1, involved in the transcription of murine leukemia virus. Molecular & Cell Biology 23(3): 831-841 (2013)

• May be used for study PBX1 mediated gene transcription regulation for endothelial to HSC differentiation in vitro by intracellular delivery of recombinant PBX1 protein using protein-delivery reagent such as ProFectin kit.
• May be used for mapping PBX1 protein-protein interaction.
• May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays.
• High purified native PBX1 protein, which may be used for specific antibody production. 
• Potential biomarker protein for cancer prognosis, such as gastric & breast cancer, et al.

MASMTGGQQMGRGHHHHHHENLYFQGGEFDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSVHSDTSN

Download Datasheet