Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-2951 | Recombinant Human SUMO2 Protein | $150 |
| Product Name: | Recombinant Human SUMO2 Protein |
| Catalog #: | HRP-2951 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human small ubiquitin-related modifier 2 (SUMO2) gene encodes an ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. It covalently attaches via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2, CBX4 or ZNF451. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to poly-ubiquitination which functions as a signal for proteasomal degradation of modified proteins. It plays a role in the regulation of sumoylation status of SETX. Full-length human SUMO2 cDNA (95aa) was constructed with codon optimization gene synthesis and expressed with a SuperGFP Protein N-terminal (sGFP; 257aa) fusion at target protein N-terminal in E.coli as highly soluble protein. The final product was chromatographically purified. |
| Gene Symbol: | SUMO2 ( SMT3B; SMT3H2 ) |
| Accession Number: | NP_008868.3 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 7.2 HEPES Buffer, with 200mM NaCl, 1mM DTT, 1mM EDTA, 30% Glycerol, 0.1% Trinton X-100. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two week. |
| Key Reference: | Marinello M, et al., SUMOylation by SUMO2 is implicated in the degradation of misfolded ataxin-7 via RNF4 in SCA7 models. Dis Model Mech 12 (1) (2019) Zhao C. et al., Overexpression of small ubiquitinlike modifier 2 ameliorates high glucoseinduced reductions in cardiomyocyte proliferation via the transforming growth factorbeta/Smad pathway Mol Med Rep 18 (6), 4877-4885 (2018) Harbani Kaur. et al., A linker strategy for Trans-FRET Assay to Determine Activation Intermediate of NEDDylation Cascade. Biotechnol. Bioeng. Vol.111, No.7 July, 1288-1295 (2014) Pedelacq JD, et al,. Engineering & characterization of a superfolder green flurescent protein. Nat Biotechnol. Jan: 24(1): 79-88. (2006). |
| Applications: |
|
| Quality Control: | Purity: > 93 % by SDS-PAGE. |
| Recombinant Protein Sequence: | MKHHHHHHQVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITHGMDELYKSGLRSGGSGGGEGSMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY Download Datasheet |