Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-0489 | Recombinant Human CD274 Protein | $125 |
| Product Name: | Recombinant Human CD274 Protein |
| Catalog #: | HRP-0489 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human programmed cell death 1 ligand 1 (PD-L1, CD274) is a cell membrane protein, which involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. Recent data indicated that cancer cells that express PDL1 promote tumor progression through inhibition of PD1-expressing immune effectors. In addtion, PDL1 modulates cell-mediated immunity in the infectious disease setting. Recombinant human CD274 extracellular domain cDNA (19-238 aa, derived from BC074984) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. Coating this recombinant protein at 5-10 ug / well (6 well plate) in a specific culture medium may be used for human T and B cell cells activation/differentiation study in vitro. |
| Gene Symbol: | CD274 (PD-L1; B7H1; PDCD1L1; PDCD1LG1) |
| Accession Number: | NP_054862.1 |
| Species: | Human |
| Package Size: | 100 ug / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Shoba Amarnath et al., The PDL1-PD1 Axis Converts Human Th1 Cells into Regulatory T Cells. Sci Transl Med 3, 111ra120 (2011) Yang,J., et al., The novel costimulatory programmed death ligand 1/B7.1 pathway is functional in inhibiting alloimmune responses in vivo. J. Immunol. 187 (3), 1113-1119 (2011) Cao,Y., et al,. Immunoregulatory molecule B7-H1 (CD274) contributes to skin carcinogenesis. Cancer Res. 71 (14), 4737-4741 (2011) Trabattoni,D., et al., B7-H1 is up-regulated in HIV infection and is a novel surrogate marker of disease progression. Blood 101 (7), 2514-2520 (2003) |
| Applications: | 1. Protein can be used as coating matrix protein for human T or B cell functions and differentiation regulation study in vitro. 2. As potential biomarker protein for infectious diseases and auto-immuno disease diagnostic development. 3. As antigen for specific antibody production. |
| Quality Control: | 1. Purity: > 90% by SDS-PAGE. 2. Functional Test: Not tested yet. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQG^GEFFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER Download Datasheet |