Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1980 | Recombinant Human ITIH4 35kD H Chain Protein | $300 |
| Product Name: | Recombinant Human ITIH4 35kD H Chain Protein |
| Catalog #: | HRP-1980 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4) gene is secreted into the blood, where it is cleaved by plasma kallikrein into two smaller forms. Expression of this gene has been detected only in liver, and it seems to be up-regulated during surgical trauma. As type II acute-phase protein (APP), ITIH4 is involved in inflammatory responses to trauma. It may also play a role in liver development or regeneration. This protein is cleaved into the following 2 chains as mature forms: 70kD and 35kD protein. Full-length mature form of human IITIH4 35 kD H chain cDNA (689 - 930aa) was constructed with codon optimization gene synthesis and expressed with T7-His-TEV cleavage site Tag (29aa) at N-terminal. This protein was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | ITIH4 (GP120; H4P; IHRP; ITI-HC4; ITIHL1; PK-120) |
| Accession Number: | NP_002209.3 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Tan Z, et al., Serological targeted analysis of an ITIH4 peptide isoform: a preterm birth biomarker and its associated SNP implications J Genet Genomics 42 (9), 507-510 (2015) Chandler KB, et al., Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4. J. Proteome Res. 13 (7), 3314-3329 (2014) Saguchi K,et al., Isolation and characterization of the human inter-alpha-trypsin inhibitor family heavy chain-related protein (IHRP) gene (ITIHL1). J. Biochem. 119 (5), 898-905 (1996) Choi-Miura NH, et al., Purification and characterization of a novel glycoprotein which has significant homology to heavy chains of inter-alpha-trypsin inhibitor family from human plasma. J. Biochem. 117 (2), 400-407 (1995) |
| Applications: | 1. May be used for in vitro ITIH4 35kD H Chain mediated pro-inflammatory pathway regulation study in various cells with this protein either as soluble factor or as coating matrix protein. 2. May be used for protein-protein interaction assay. 3. Potential anti- pro-inflammatory response target protein for treatment of various auto-immuno-diseases using ITIH4 35kD H Chain blocking antibodies. 4. As immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFRLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL Download Datasheet |