Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| RP-0053 | Recombinant GFP-9R Protein | $160 |
| Product Name: | Recombinant GFP-9R Protein |
| Catalog #: | RP-0053 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | This version of GFP is the second generation monomeric green fluorescent protein ( Enhanced GFP ) that has improved brightness and photostability. This recombinant GFP protein was constructed with N-terminal tag of HA2 peptide for efficient endosomal release after intracellular protein delivery, and C-terminal 9 arginine domain / 6His Tag, which will efficiently delivery this recombinant protein intracellularly. This EGFP-9R protein was expressed in E.coli as soluble protein and was purified using Ni-NTA Superflow column. Incubating this protein in various culture mediums at 2ug/ ml concentration could be used for monitoring intracellular protein delivery efficiency. |
| Gene Symbol: | EGFP |
| Accession Number: | AF288620 |
| Species: | Jellyfish Aequorea Victoria |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in PBS buffer / 20% Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least two weeks. |
| Key Reference: | Cutler,S.R., et al. Random GFP::cDNA fusions enable visualization of subcellular structures in cells of Arabidopsis at a high frequency. Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3718- 3723 (2000) Hongyan Zhou, et al. Generation of Induced Pluripotent Stem Cells Using Recombinant Proteins. Cell Stem Cell. 4: 381-384 (2009). |
| Applications: | 9 arginine tag (9R Tag) modified EGFP protein, which can be used as negative control in any transcription factor protein intracellular delivery experiments. |
| Quality Control: |
This EGFP-9R, have a single excitation peak centered at about 488 nm, with an emission peak wavelength of 509 nm. |
| Recombinant Protein Sequence: | MGDIMGEWGNEIFGAIAGFLGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSRHRRHRQRSRSRAAARRRRRRRRR Download Datasheet |