Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-1832 | Recombinant Human CD355 Protein | $300 |
| Product Name: | Recombinant Human CD355 Protein |
| Catalog #: | hRP-1832 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human cytotoxix and regulatory T-cell molecule, (CRTAN, also named as CD355) gene encodes a type I transmembrane protein with V and C1-like Ig domains. It is up-regulated in CD4+ and CD8+ T cells. CD355 interacts with CADM1 promotes natural killer (NK) cell cytotoxicity and interferon-gamma (IFN-gamma) secretion by CD8+ cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM3 in vivo. Extracellular domain of human CD355 cDNA (18 – 287aa, Isoform-I) was constructed with codon optimization using gene synthesis technology and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CD355 (CRTAM) |
| Accession Number: | NP_062550.2 |
| Species: | Human |
| Package Size: | 25 µg / Vial |
| Composition: | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Rojas-Marquez C, et al., CRTAM is negatively regulated by ZEB1 in T cells. Mol. Immunol. 66 (2), 290-298 (2015) Zhang S,et al., Competition of cell adhesion and immune recognition: insights into the interaction between CRTAM and nectin-like 2. Structure 21 (8), 1430-1439 (2013) Dessarthe B, et al., CRTAM receptor engagement by Necl-2 on tumor cells triggers cell death of activated Vgamma9Vdelta2 T cells. J. Immunol. 190 (9), 4868-4876 (2013) Du R, et al., Genome-wide association study reveals class I MHC-restricted T cell-associated molecule gene (CRTAM) variants interact with vitamin D levels to affect asthma exacerbations. J. Allergy Clin. Immunol. 129 (2), 368-373 (2012) |
| Applications: | 1. May be used for in vitro CD355 mediated CD4+ and CD8+ T cell activation regulation study with this protein either as soluble factor or as coating matrix protein. 3. Potential biomarker/therapeutic protein for various cancer treatments by targeting CD355 with specific antibody. 4. As immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFSLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG Download Datasheet |