Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-1803 | Recombinant Human CD127 Protein | $300 |
| Product Name: | Recombinant Human CD127 Protein |
| Catalog #: | hRP-1803 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human interleukin-7 receptor subunit alpha (IL7R, also named as CD127) gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukins 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in V(D)J recombination during lymphocyte development. Defects in this gene may be associated with severe combined immunodeficiency (SCID). Alternatively spliced transcript variants have been found. Full-length extracellular domain of human CD127 cDNA (21 - 239aa, derived from BC067537) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein was expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CD127 (IL7R; IL7RA) |
| Accession Number: | NP_002176 |
| Species: | Human |
| Package Size: | 40 µg / Vial |
| Composition: | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Chandran SS,et al., Tumor-Specific Effector CD8+ T Cells That Can Establish Immunological Memory in Humans after Adoptive Transfer Are Marked by Expression of IL7 Receptor and c-myc. Cancer Res. 75 (16), 3216-3226 (2015) Leiding JW, et al., Hypomorphic interleukin-7 receptor alpha-chain mutations and T-cell deficiency: a delay in diagnosis. Ann. Allergy Asthma Immunol. 115 (1), 1-3 (2015) Albareda MC, et al., Perturbed T cell IL-7 receptor signaling in chronic Chagas disease. J. Immunol. 194 (8), 3883-3889 (2015) |
| Applications: | 1. May be used for in vitro CD127 mediated IL7 and IL2 pathway regulation study for various cells, such as T cells, with this protein either as soluble factor or as coating matrix protein. 2. May be used for protein-protein interaction mapping. 3. May be used as enzymatic substrate for various proteases. 4. Potential biomarker protein for monitoring CD8+T effector cell activation status in various dieases. 5. As immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP Download Datasheet |