Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-0915 | Recombinant Human COMMD10 Protein | $300 |
| Product Name: | Recombinant Human COMMD10 Protein |
| Catalog #: | hRP-0915 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human COMM domain-containing protein family is defined by the presence of a conserved and unique motif termed the COMM (copper metabolism gene MURR1) domain, which functions as an interface for protein-protein interactions. Like MURR1, several of these factors also associate with and inhibit NF-kappaB. The proteins designated as COMMD or COMM domain containing 1-10 are extensively conserved in multicellular eukaryotic organisms and define a novel family of structural and functional homologs of MURR1. COMM domain-containing protein 10 (COMMD10)’s function is currently unknown, but has been associated with lipid metabolic disease and bipolar disorder by SNP mapping. Full-length mature human COMMD10 (202 aa) gene was constructed with 17 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | HADH (HSPC305; PTD002) |
| Accession Number: | NP_057228 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Burstein,E., et al., COMMD proteins, a novel family of structural and functional homologs of MURR1. J. Biol. Chem. 280 (23), 22222-22232 (2005) |
| Applications: | 1. May be used for in vitro COMMD10 mediated NFkb pathway regulation study by intracellular delivery of this protein with “ProFectin” reagent. 2. May be used for mapping COMMD10 protein-protein interaction assay. 3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays. 4. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFGSMAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT Download Datasheet |