Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-0892 | Recombinant Human MPHOSPH6 Protein | $300 |
| Product Name: | Recombinant Human MPHOSPH6 Protein |
| Catalog #: | hRP-0892 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The exosome is a complex of 3′–5′ exoribonucleases and RNA-binding proteins, which is involved in processing or degradation of different classes of RNA. In human cells, C1D, KIAA0052/hMtr4p are associated with the exosome and thus might regulate its functional activities. Human M-phase phosphoprotein 6 (MPHOSPH6) is RNA-binding protein, as one of member which identified in exosome complex, has recently been identified to interacts with C1D and hMtr4P. So, MPHOSPH6 may plays a role in the recruitment of the exosome to pre-rRNA to mediate the 3' end processing of the 5.8S rRNA. Full-length mature human MPHOSPH6 (160aa) gene was constructed with 15 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | MPHOSPH6 (MPP; MPP-6; MPP6) |
| Accession Number: | NP_005783 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Schilders,G., et al., C1D and hMtr4p associate with the human exosome subunit PM/Scl-100 and are involved in pre-rRNA processing. Nucleic Acids Res. 35 (8), 2564-2572 (2007) Schilders,G., MPP6 is an exosome-associated RNA-binding protein involved in 5.8S rRNA maturation. Nucleic Acids Res. 33 (21), 6795-6804 (2005) |
| Applications: | 1. May be used for in vitro MPHOSPH6 mediated 5.8s rRNA maturation regulation study with “ProFectin” based intracellular delivery of this protein. 2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development. 3. May be used for mapping MPHOSPH6 protein-protein interaction. 4. Potential diagnostic biomarker for gastrointestinal stromal tumors. 5. May be used as antigen for specific antibody development. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMAAERKTRLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKEKESFIIEEQSFLLCEDLLYGRMSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSDEEMARRYETLVGTIGKKFARKRDHANYEEDENGDITPIKAKKMFLKPQD Download Datasheet |