Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-0852 | Recombinant Human NAA20 Protein | $300 |
| Product Name: | Recombinant Human NAA20 Protein |
| Catalog #: | hRP-0852 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human N-alpha-acetyltransferase 20 (NAA20) is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N (alpha)-terminal acetylation of methionine residues when they are followed by asparagine. NatB activities has been linked to regulate mTOR signaling pathway, which involved in many tumorigenesis. Full-length human NAA20 (178 aa, Isoform-A) gene was constructed with 15 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | NAA20 (NAT3; NAT5) |
| Accession Number: | NP_057184 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Evjenth,R., Human Naa50p (Nat5/San) displays both protein N alpha- and N epsilon-acetyltransferase activity. J. Biol. Chem. 284 (45), 31122-31129 (2009) Starheim,K.K., et al., Identification of the human N(alpha)-acetyltransferase complex B (hNatB): a complex important for cell-cycle progression. Biochem. J. 415 (2), 325-331 (2008) Jiang,B., et al., Peptide mimic isolated by autoantibody reveals human arrest defective 1 overexpression is associated with poor prognosis for colon cancer patients. Am. J. Pathol. 177 (3), 1095-1103 (2010) |
| Applications: | 1. May be used for in vitro NatB mediated cell cycle regulation study with intracellular delivery of this protein. 2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development. 3. May be used for mapping NAA20 protein-protein interaction. 4. Potential diagnostic biomarker for cancer. 5. May be used as antigen for specific antibody development. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE Download Datasheet |