Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hTF-1760 | Recombinant Human Sox15 Protein | $300 |
| Product Name: | Recombinant Human Sox15 Protein |
| Catalog #: | hTF-1760 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human Sox15 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Recent data indicated that Sox15 plays a role in suppressing the Wnt/b-catenin signaling pathway in pancreatic cancer. Full-length human Sox15 cDNA ( 232 aa, derived from BC000985 ) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E Coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | Sox15 (Sox20; Sox26; Sox27) |
| Accession Number: | NP_008873 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Thu KL, et al., SOX15 is a candidate tumor suppressor in pancreatic cancer with a potential role in Wnt/beta-catenin signaling. Oncogene 33 (3), 279-288 (2014) Sakai N, et al., Identification of NR5A1 (SF-1/AD4BP) gene expression modulators by large-scale gain and loss of function studies. J. Endocrinol. 198 (3), 489-497 (2008) Meeson AP, et al., Sox15 and Fhl3 transcriptionally coactivate Foxk1 and regulate myogenic progenitor cells. EMBO J. 26 (7), 1902-1912 (2007) |
| Applications: | 1. May be used for in vitro Sox15 mediated gene transcription regulation study for early embryonic cell and various cancer cells by intracellular delivery of this protein with ProFectin reagent. 2. May be used for mapping Sox15 protein-protein interaction assay. 3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays. 4. Potential biomarker protein for prognostic diagnosis of pancreatic cancer. 5. May be used for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVKRPMNAFMVWSSAQRRQMAQQNPKMHNSEISKRLGAQWKLLDEDEKRPFVEEAKRLRARHLRDYPDYKYRPRRKAKSSGAGPSRCGQGRGNLASGGPLWGPGYATTQPSRGFGYRPPSYSTAYLPGSYGSSHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL Download Datasheet |