Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-0734 | Recombinant Human ZNF395 Protein | $300 |
| Product Name: | Recombinant Human ZNF395 Protein |
| Catalog #: | hRP-0734 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human ZNF395 encodes a member of zinc finger transcription factor, is a nuclei-cytoplasmic shuttling factor with the ability to inhibit cell growth. It has been identified by its ability to bind to GC-rich sequence elements within upstream promoter region of certain HPV (human papillomavirus) type and of the Huntingtin protein. Human ZNF395 mRNA was highly enriched in CD19+ B cells, recent data indicated that ZNF395 directly binds to SAP30, a component of the mSIN3A-HDAC1 complex, may play a role in epigenomic regulations in immuno-response pathways. Full-length human ZNF395 (513 aa) gene was constructed with 15aa N-terminal T7 tag and expressed in E.coli as inclusion bodies, refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | ZNF395 (HDBP-2; HDRF-2; PBF-1) |
| Accession Number: | NP_061130 |
| Species: | Human |
| Package Size: | 20 µg / Vial |
| Composition: | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Tanaka,K., et al., Novel nuclear shuttle proteins, HDBP1 and HDBP2, bind to neuronal cell-specific cis-regulatory element in the promoter for the human Huntington's disease gene. J. Biol. Chem. 279 (8), 7275-7286 (2004) Tsukahara,T., et al., Identification of human autologous cytotoxic T-lymphocyte-defined osteosarcoma gene that encodes a transcriptional regulator, papillomavirus binding factor. Cancer Res. 64 (15), 5442-5448 (2004) Sichtig,N., et al., Papillomavirus binding factor binds to SAP30 and represses transcription via recruitment of the HDAC1 co-repressor complex. Arch. Biochem. Biophys. 467 (1), 67-75 (2007) |
| Applications: | 1. May be used for in vitro mSIN3A-HDAC1 complex regulations study using recombinant ZNF395 protein intracellular delivery method. 2. May be used as enzymatic substrate protein for Kinase and ubiquitin assay. 3. May be used for mapping ZNF395 protein binding partner in protein–protein interaction assay in B cells. 4. May be used as antigen for specific antibody development. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFASVLSRRLGKRSLLGARVLGPSASEGPSAAPPSEPLLEGAAPQPFTTSDDTPCQEQPKEVLKAPSTSGLQQVAFQPGQKVYVWYGGQECTGLVEQHSWMEGQVTVWLLEQKLQVCCRVEEVWLAELQGPCPQAPPLEPGAQALAYRPVSRNIDVPKRKSDAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDISDSGSSTTSGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMYKCLWPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPTSEPAPTPSMTGLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPVSPHIYTSVSWAAAPSAACSLSPVRSRSLSFSEPQQPAPAMKSHLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRFLD Download Datasheet |