Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-1746 | Recombinant Human CD354 Protein | $200 |
| Product Name: | Recombinant Human CD354 Protein |
| Catalog #: | hRP-1746 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human Triggering receptor expressed on myeloid cell1 (TREM1, also named as CD354) gene encodes a receptor belonging to the Ig superfamily that is expressed on myeloid cells. This protein amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers. It is a crucial mediator of septic shock. Full-length extracellular domain of human CD354 extracellular domain cDNA (21 - 2305aa, Isoform-1) was constructed by gene synthesis with codon optimization technology and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E Coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CD354 (TREM1) |
| Accession Number: | NP_061113.1 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Burmistrova,A.L. et al., Soluble form of trigger receptor expressed on myeloid cells-1 as a marker of burn wound mixed infection. Zh. Mikrobiol. Epidemiol. Immunobiol. 6, 63-68 (2013) Dopheide JF, et al., Critical limb ischaemia is characterised by an increased production of whole blood reactive oxygen species and expression of TREM-1 on neutrophils. Atherosclerosis 229 (2), 396-403 (2013) Shi JX, et al., Diagnostic value of sTREM-1 in bronchoalveolar lavage fluid in ICU patients with bacterial lung infections: a bivariate meta-analysis. PLoS ONE 8 (5), E65436 (2013) Bleharski JR, et al., A role for triggering receptor expressed on myeloid cells-1 in host defense during the early-induced and adaptive phases of the immune response. J. Immunol. 170 (7), 3812-3818 (2003) |
| Applications: | 1. May be used for in vitro CD354 mediated neutrophil and monocyte-related inflammatory responses regulatory study with this protein as either soluble factor or coating matrix protein. 2. May be used for CD354 protein-protein interaction assay. 3. Potential diagnostic biomarker for systematic infections, such as bacterial lung infection, et al. 4. May be used for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIRVPVFN Download Datasheet |