Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-0708 | Recombinant Human ACAD8 Protein | $300 |
| Product Name: | Recombinant Human ACAD8 Protein |
| Catalog #: | hRP-0708 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human isobutyryl-CoA dehydrogenase (ACAD8) gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency. Full-length human ACAD8 (23-415aa) gene was constructed with 15 N-terminal T7 tag and expressed in E. coli as inclusion bodies, refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | ACAD8 (ARC42) |
| Accession Number: | NP_055199 |
| Species: | Human |
| Package Size: | 40 µg / Vial |
| Composition: | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Nguyen,T.V., et al., Identification of isobutyryl-CoA dehydrogenase and its deficiency in humans. Mol. Genet. Metab. 77 (1-2), 68-79 (2002) Wollmer,M.A., et al. Association study of cholesterol-related genes in Alzheimer's disease. Neurogenetics 8 (3), 179-188 (2007) Hendrickson,S.L., et al., Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. PLoS ONE 5 (9), E12862 (2010) |
| Applications: | 1. May be used for in vitro human cell metabolism of fatty acids or branch chained amino acids study with “ProFectin” reagent based intracellular delivery of this protein. 2. May be used as specific substrate protein for kinase and ubiqitin enzymes. 3. As immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFGSLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGPGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE Download Datasheet |