| Cata #: | Name of Product: | Price: |
| hRP-0706 | Recombinant Human NOC4 Protein | $300 |

| Product Name: | Recombinant Human NOC4 Protein |
| Catalog #: | hRP-0706 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human COX4 neighbor (NOC4) gene, also known as COX4NB, belongs to the UPF0172 (NOC4) family and is found on chromosome 16, adjacent to the gene that encodes COX4. This protein is expressed in liver, pancreas, heart, lung, kidney, brain, skeletal muscle, and placenta. Expression levels are highest in pancreas and moderate in heart, skeletal muscle, and placenta. Currently, we have a very limited knowledge about this protein functions in vivo. Full-length human NOC4 gene was constructed with 17 N-terminal T7 tag and expressed in E.coli as inclusion bodies, refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | NOC4 (COXNB; C16orf2; FAM158B) |
| Accession Number: | NP_001912 |
| Species: | Human |
| Package Size: | 20 µg / Vial |
| Composition: | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Bachman,N.J., et al., The 5' region of the COX4 gene contains a novel overlapping gene, NOC4. Mamm. Genome 10 (5), 506-512 (1999) Zhang,X., et al., MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer. Carcinogenesis 31 (12), 2118-2123 (2010) |
| Applications: | 1. May be used for in vitro human Noc4 functions in pancreatic cells study with “ProFectin” reagent based intracellular delivery of this protein. 2. May be used as specific substrate protein for kinase and ubiqitin enzymes. 3. As immunogen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC Download Datasheet |