Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hTF-0232 | Recombinant Human MED6 Protein | $300 |
| Product Name: | Recombinant Human MED6 Protein |
| Catalog #: | hTF-0232 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human mediator of RNA polymerase II transcription subunit 6 (MED6) is a component of the Mediator complex, a co-activator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors. Auto-antibody for MED6 has been detected in renal-cell carcinoma patients. Full-length human MED6 ( 157aa, Isoform-II ) gene was constructed with 15 aa N-terminal T7 Tag and expressed in E.coli as inclusion bodies. The protein was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | MED6 (ARC33; NY-REN-28) |
| Accession Number: | NP_005457.2 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
| Key Reference: | Ruiz A., et al Characterization of the influence of mediator complex in HIV-1 transcription. JBC Oct 3; 289(40): 27665 - 76 (2014). Scanian M.J., et al Antigens recognized by autologous antibody in patients with renal-cell carcinoma. Int. J. Cancer 83: 456-464. (1999). Lee HK, et al., MED25 is distinct from TRAP220/MED1 in cooperating with CBP for retinoid receptor activation. EMBO J. 26 (15), 3545-3557 (2007) Zhiu H, et al., Mediator modulates Gli3-dependent sonic hedgehog signaling. Mol. Cell. Biol.26: 8667-8682 (2006) |
| Applications: | 1. May be used for in vitro MED6 mediated basal RNA polymerase II transcription regulation study for various cells by intracellular delivery of this protein with “ProFectin” reagent. 2. May be used for mapping MED6 protein-protein interaction. 3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays. 4. Potential biomarker protein for monitoring renal-cell carcinoma diagnoses. 5. As immunogen for specific antibody development. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSA FDEAMSYCRYHPSKGYWWHFKDHEEQGK Download Datasheet |