Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-1381 | Recombinant Human GRB2 Protein | $300 |
| Product Name: | Recombinant Human GRB2 Protein |
| Catalog #: | hRP-1381 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The protein encoded by human Growth factor receptor-bound protein 2 (GRB2) gene binds the epidermal growth factor receptor and contains one SH2 domain and two SH3 domains. Its two SH3 domains direct complex formation with proline-rich regions of other proteins, and its SH2 domain binds tyrosine phosphorylated sequences. This gene is similar to the Sem5 gene of C.elegans, which is involved in the signal transduction pathway. Recent data indicated that GRB2 plays a role as modifier of b-catenin-dependent Wnt signaling by interacting with Dvl2 and acts downstream of FAK to amplify b-catenin-dependent transcription through a mechanism involving Rac1, Jnk and c-jun. Full-length human GRB2 cDNA (2 – 217 aa) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | GRB2 (ASH; Grb3-3; MST084; MSTP084; EGFRBP-GRB2) |
| Accession Number: | NP_002077.1 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Steve P, et al., Integration of the b-Catenin-dependent Wnt pathway with integrin signaling through the adaptor molecule Grb2. Plos One. Vol:4, Issue 11, e7841.(2013) Strunk U, et al., Role of herpes simplex virus VP11/12 tyrosine-based motifs in binding and activation of the Src family kinase Lck and recruitment of p85, Grb2, and Shc. J. Virol. 87 (20), 11276-11286 (2013) |
| Applications: | 1. May be used for in vitro protein mediated Wnt / b-catenin pathway regulation study in tumor cell transformation or ES cell differentiation with this protein as either coating matrix protein or soluble factor. 2. May be used for GRB2 protein-protein interaction assay. 3. Enzymatic substrate for various proteases. 4. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGSEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV Download Datasheet |