Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| hRP-0197 | Recombinant Human CHRNA1 Protein | $300 |
| Product Name: | Recombinant Human CHRNA1 Protein |
| Catalog #: | hRP-0197 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The muscle acetylcholine receptor consists of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma and delta subunits. Human acetylcholine receptor subunit alpha (CHRNA1) encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. This protein has been identified as a major auto-antigen in myasthenia gravis disease. Human CHRNA1 protein extracellular domain (21-209aa) was constructed with N-terminal His Tag for high level expression. This protein expressed in E. coli as inclusion bodies, refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CHRNA1 (ACHRA; CMS1A; CMS2A; FCCMS; SCCMS) |
| Accession Number: | NP_000070.1 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Garchon, H.J., et al. Involvement of human muscle acetylcholine receptor alpha-subunit gene (CHRNA) in susceptibility to myasthenia gravis. PNAS. 91. 4668-4672 (1994) Niarchos A, et al., Expression of a highly antigenic and native-like folded extracellular domain of the human alpha1 subunit of muscle nicotinic acetylcholine receptor, suitable for use in antigen specific therapies for Myasthenia Gravis. PLoS ONE 8 (12), E84791 (2013) Chang PM, et al., High expression of CHRNA1 is associated with reduced survival in early stage lung adenocarcinoma after complete resection. Ann. Surg. Oncol. 20 (11), 3648-3654 (2013) |
| Applications: | 1. May be used as auto-antibodies detection reagent, which will react with sera of Myasthenia Gravis patients. 2. May be used for in vitro CHRNA1 mediated acetlycholine binding / channel gating pathway regulations study by intracellular delivery of this protein with ProRectin reagent. 3. May be used for mapping CHRNA1 protein-protein interaction. 4. As Immunogen for specific antibody development. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MGSSHHHHHHSSGLVPRGSHMGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVT Download Datasheet |