Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1682 | Recombinant Human ENDOU Protein | $300 |
| Product Name: | Recombinant Human ENDOU Protein |
| Catalog #: | HRP-1682 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human poly(U)-specific endoribonuclease (ENDOU) gene encodes a protein with endoribonuclease & protease activities. It is highly specific expression in the placenta. Endoribonuclease that cleaves single-stranded RNAs at uridylates and releases products that have 2'-3'-cyclic phosphate termini. This protein may be useful as a tumor marker. Multiple alternatively spliced transcript variants have been found for this protein. Full-length Human ENDOU cDNA (368aa, Isoform-II, derived from BC074729) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (33aa) fusion at its N-terminal. This protein was expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | ENDOU (P11; PP1; PRSS26) |
| Accession Number: | NP_006016 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Laneve P, et al., The tumor marker human placental protein 11 is an endoribonuclease. J. Biol. Chem. 283 (50), 34712-34719 (2008) Grundmann U, et al., Cloning and expression of a cDNA encoding human placental protein 11, a putative serine protease with diagnostic significance as a tumor marker. DNA Cell Biol. 9 (4), 243-250 (1990) |
| Applications: | 1. May be used for in vitro ENDOU mediated placenta derived cell & tumor cells differentiation regulations study with this protein as either soluble factor or coating matrix protein. 2. May be used for ENDOU protein-protein interaction mapping. 3. Potential biomarker protein for clinical applications such as monitoring pancreatic cancer progression. 4. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGEFRACISLVLAVLCGLAWAEDHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST Download Datasheet |