Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-0252 | Recombinant Human CTF1 Protein | $300 |
| Product Name: | Recombinant Human CTF1 Protein |
| Catalog #: | HRP-0252 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human CTF1 (Cardiotrophin-1) is a 201 amino acid member of the interleukin-6 superfamily. It was identified by its ability to induce hypertrophic response in cardiac myocytes. CTF-1 mRNA levels were found both in cardiac myocytes and in cardiac nonmyocytes. CTF 1 was also detected in abundance in normal adult human lung and was expressed in both fetal and adult airway smooth muscle cells. This protein has been demonstrated to play important roles in vitro for increasing cardio, neuronal, and hepatocytes survivals. CTF1, as Lif protein, activates gp130 dependent signaling and stimulates the Janus kinase/signal transducers and activators of transcription (JAK/STAT) pathway to transduce hypertrophic and cytoprotective signals in cardiac myocytes. Full length recombinant human CTF1 protein was constructed as a fusion protein and was highly purified using affinity matrix from E. coli. After specific proteinase cleavage, native CTF1 protein was collected and suspended in PBS buffer. |
| Gene Symbol: | CTF1 (CT1) |
| Accession Number: | NP_001321 |
| Species: | Human |
| Package Size: | 20 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in PBS Buffer, no any carrier protein. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Pennica,D., et al. Cardiotrophin-1, a cytokine present in embryonic muscle, supports long-term survival of spinal motoneurons. Neuron 17 (1), 63-74 (1996)
Pennica,D., et al. Cardiotrophin-1. Biological activities and binding to the leukemia inhibitory factor receptor/gp130 signaling complex. J. Biol. Chem. 270 (18), 10915-10922 (1995) |
| Applications: | 1. Active recombinant protein, may be used for its functional assay. 2. As immunogen for specific antibody production. |
| Quality Control: | 1. Purity: > 95% by SDS-PAGE and visualized by silver stain. 2. Functional Test: Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 0.25 – 0.85 ng/ml. 3. Endotoxin Level: < 1EU per 1 ug of protein by the LAL method. |
| Recombinant Protein Sequence: | SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA Download Datasheet |