| Cata #: | Name of Product: | Price: | 
| HRP-1627 | Recombinant Human CD357 Protein | $300 | 

| Product Name: | Recombinant Human CD357 Protein | 
| Catalog #: | HRP-1627 | 
| Manufacture: | LD Biopharma, Inc. | 
| Intruduction: | Human tumor necrosis factor receptor superfamily member 18 (TNFRSF18, also named as CD357) is a receptor for TNFSF18. CD357 protein has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25+ / CD4+ regulatory T cells. CD357 Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. It also mediated NF-kappa-B activation via the TRAF2/NIK pathway. Full-length extracellular domain of human CD357 extracellular domain cDNA (26-162 aa) was constructed by gene synthesis with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. | 
| Gene Symbol: | CD357 (TNFRSF18, AITR; GITR; GITR-D) | 
| Accession Number: | NP_004186 | 
| Species: | (TNFRSF18, AITR; GITR; GITR-D) | 
| Package Size: | 50 µg / Vial | 
| Composition: | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. | 
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. | 
| Key Reference: | Xufre C, et al., Low frequency of GITR+ T cells in ex vivo and in vitro expanded Treg cells from type 1 diabetic patients. Int. Immunol. 25 (10), 563-574 (2013) Liu Y, et al., Novel tumor suppressor function of glucocorticoid-induced TNF receptor GITR in multiple myeloma. PLoS ONE 8 (6), E66982 (2013) Arandi N, et al., Frequency and expression of inhibitory markers of CD4(+) CD25(+) FOXP3(+) regulatory T cells in patients with common variable immunodeficiency. Scand. J. Immunol. 77 (5), 405-412 (2013) | 
| Applications: | 1. May be used for in vitro CD357 mediated T cell activation regulation study with this protein as either coating matrix protein or soluble factor. 2. May be used for CD357 protein-protein interaction assay. 3. Potential biomarker protein for clinical monitoring T cell function in vitro. 4. As antigen for specific antibody production. | 
| Quality Control: | Purity: > 90% by SDS-PAGE. | 
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGEFQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEP Download Datasheet |