Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1516 | Recombinant Human ROR1 Protein | $200 |
| Product Name: | Recombinant Human ROR1 Protein |
| Catalog #: | HRP-1516 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human tyrosine protein kinase transmembrane receptor ROR1 gene encodes a receptor tyrosine kinase-like orphan receptor that modulates neurite growth in the central nervous system. The encoded protein is a glycosylated type I membrane protein that belongs to the ROR subfamily of cell surface receptors. It is a pseudokinase that lacks catalytic activity and may interact with the non-canonical Wnt signalling pathway. ROR1 gene is highly expressed during early embryonic development but expressed at very low levels in adult tissues. Increased expression of this gene is associated with B-cell chronic lymphocytic leukaemia. So anti-ROR1 specific antibody may be useful in cancer therapy by selectively targeting ROR1+ cancer cells. Full-length extracellular domain of human ROR1 extracellular domain cDNA (30-406 aa) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | ROR1 (NTRKR1; dJ537F10) |
| Accession Number: | NP_005003 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT . |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Widhopf GF et al., ROR1 can interact with TCL1 and enhance leukemogenesis in Emu-TCL1 transgenic mice. Proc. Natl. Acad. Sci. U.S.A. 111 (2), 793-798 (2014)
Cui B, et al., Targeting ROR1 inhibits epithelial-mesenchymal transition and metastasis. Cancer Res. 73 (12), 3649-3660 (2013) Hudecek M, et al., Receptor affinity and extracellular domain modifications affect tumor recognition by ROR1-specific chimeric antigen receptor T cells. Clin. Cancer Res. 19 (12), 3153-3164 (2013) Hojjat-Farsangi M, et al., Inhibition of the receptor tyrosine kinase ROR1 by anti-ROR1 monoclonal antibodies and siRNA induced apoptosis of melanoma cells. PLoS ONE 8 (4), E61167 (2013) |
| Applications: | 1. May be used for in vitro ROR1 mediated T cell and neuronal cell differentiation regulation study with this protein either as soluble factor or as coating matrix protein. 2. May be used for protein-protein interaction assay. 3. Potential biomarker protein for cancer therapy applications. 4. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGEFQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILY Download Datasheet |