Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1463 | Recombinant Human CD62L Protein | $200 |
| Product Name: | Recombinant Human CD62L Protein |
| Catalog #: | HRP-1463 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human L-selectin (also named as CD62L) gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. CD62L is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Recent data indicated that in the human CD8+ population, CD62Lhi positive cells are true human stem-like T cells. Full-length of human CD62L extracellular domain cDNA (39-332 aa, derived from BC020758) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CD62L (SELL; LAM1; LEU8; LNHR; LSEL) |
| Accession Number: | NP_000646.2 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Stemberger C, et al. Lowest numbers of primary CD8+ T cells can reconstitute protective immunity upon adoptive immunotherapy. Blood. 124(4):628–637.(2014)
Luca Gattinoni, et al., A human memory T cell subset with stem cell-like properties. Nature Medicine 17, 1290-1297. (2011). Schwab N, et al., L-selectin is a possible biomarker for individual PML risk in natalizumab-treated MS patients. Neurology 81 (10), 865-871 (2013) Deng W, et al., Calmodulin adopts an extended conformation when interacting with L-selectin in membranes. PLoS ONE 8 (5), E62861 (2013) Elsenberg EH, et al., Toll-Like Receptor induced CD11b and L-selectin response in patients with coronary artery disease. PLoS ONE 8 (4), E60467 (2013) |
| Applications: | 1. May be used for in vitro CD62L mediated T cell and endothelial cell differentiation regulation study with this protein as either coating matrix protein or soluble factor. 2. May be used for protein-protein interaction assay. 3. Potential biomarker protein for clinical applications such as monitoring lung cancer or MS diseases. 4. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGEFLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN Download Datasheet |