Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-0925 | Recombinant Human WTAP Protein | $300 |
| Product Name: | Recombinant Human WTAP Protein |
| Catalog #: | HRP-0925 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. Human Pre-mRNA-splicing regulator WTAP gene encodes a WT1-associating Protein (WTAP), which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. It is known that WTAP regulates G2/M cell-cycle tranition by binding to the 3’ UTR of CCNA2, which enhancers its stability. At least 3 isoforms of this gene was identified. Full-length of human WTAP (151aa, Isoform-II) gene was constructed with 15 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | WTAP (KIAA0105) |
| Accession Number: | NP_690596 |
| Species: | Human |
| Package Size: | 50 ug / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Jin,D.I., et al., Expression and roles of Wilms' tumor 1-associating protein in glioblastoma. Cancer Sci. 103 (12), 2102-2109 (2012)
Small,T.W. et al., Nuclear degradation of Wilms tumor 1-associating protein and survivin splice variant switching underlie IGF-1-mediated survival. J. Biol. Chem. 284 (37), 24684-24695 (2009) Ortega,A., et al., Biochemical function of female-lethal (2)D/Wilms' tumor suppressor-1-associated proteins in alternative pre-mRNA splicing. J. Biol. Chem. 278 (5), 3040-3047 (2003) |
| Applications: | 1. May be used for in vitro WTAP (Isoform-II) mediated tumorgenesis pathway regulation study by intracellular delivery of this protein with “ProFectin” reagent. 2. May be used for mapping WTAP protein-protein interaction assay. 3. May be used as specific substrate protein for kinase, and ubiquitin (Sumo pathway) related enzyme functional screening assays. 4. Potential Diagnostic biomarker protein for various tumors. 5. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPDR Download Datasheet |