Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1188 | Recombinant Human CLEC11A Protein | $200 |
| Product Name: | Recombinant Human CLEC11A Protein |
| Catalog #: | HRP-1188 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human C-type lectin domain family 11 member A (CLEC11A) gene encodes a member of the C-type lectin superfamily. The encoded protein is a secreted sulfated glycoprotein and functions as a growth factor for primitive hematopoietic progenitor cells. Recent data indicated that CLEC11a plays a major role in enhanced erythropoiesis during malarial infection. An alternative splice variant has been described but its biological nature has not been determined. Full-length extracellular domain of human CLEC11A cDNA (22 – 323 aa, derived from BC005810) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CLEC11A (CLECSF3; LSLCL; p47; SCGF) |
| Accession Number: | NP_002966 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Da Riva,L., et al., Proteomic detection of a large amount of SCGFalpha in the stroma of GISTs after imatinib therapy. J Transl Med 9, 158 (2011)
Ouma,C., et al., A novel functional variant in the stem cell growth factor promoter protects against severe malarial anemia. Infect. Immun. 78 (1), 453-460 (2010). |
| Applications: | 1. May be used for in vitro -glycosylated CLEC11A protein mediated HSC regulation study with this protein as either coating matrix protein or as soluble factor. 2. May be used for CLEC11A protein – protein interaction assay. 3. May be used as enzymatic substrate for various proteases. 4. May be used for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF Download Datasheet |