Cata #: | Name of Product: | Price: |
HRP-1119 | Recombinant Human IGSF11 Protein | $150 |
Product Name: | Recombinant Human IGSF11 Protein |
Catalog #: | HRP-1119 |
Manufacture: | LD Biopharma, Inc. |
Intruduction: | Human immunoglobulin superfamily member 11 (IGSF11) gene encodes a member of the immunoglobulin-like domain-containing superfamily. Proteins in this superfamily contain varying numbers of immunoglobulin-like domains and are thought to participate in the regulation of interactions between cells. IGSF11 is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR) and endothelial cell-selective adhesion molecule (ESAM). Full-length extracellular domain of human IGSF11 cDNA (24-241aa, derived from BC034411) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
Gene Symbol: | IGSF11 (BT-IgSF; CT119; CXADRL1; Igsf13; VSIG3) |
Accession Number: | NP_689751 |
Species: | Human |
Package Size: | 50 µg / Vial |
Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Key Reference: | Harada,H., et al., BT-IgSF, a novel immunoglobulin superfamily protein, functions as a cell adhesion molecule. J. Cell. Physiol. 204 (3), 919-926 (2005)
Watanabe,T., et al., Identification of immunoglobulin superfamily 11 (IGSF11) as a novel target for cancer immunotherapy of gastrointestinal and hepatocellular carcinomas. Cancer Sci. 96 (8), 498-506 (2005) Suzu,S., et al., Molecular cloning of a novel immunoglobulin superfamily gene preferentially expressed by brain and testis. Biochem. Biophys. Res. Commun. 296 (5), 1215-1221 (2002) |
Applications: | 1. May be used for in vitro IGSF11 mediated neuronal and testis cells differentiation regulation study with this protein as either coating matrix protein or soluble factor. 2. May be used for IGSF11 protein – protein interaction. 3. May be used for specific antibody production. |
Quality Control: | Purity: > 90% by SDS-PAGE. |
Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG download Datasheet |