Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1303 | Recombinant Human Profiling-1 Protein | $300 |
| Product Name: | Recombinant Human Profiling-1 Protein |
| Catalog #: | HRP-1303 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human profiling 1 (PFN1) gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. By binding to PIP2, PFN1 inhibits the formation of IP3 and DG. It also inhibits androgen receptor (AR) and HTT aggregation and binding of G-actin is essential for its inhibition of AR. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1. Full-length human PFN1 cDNA (2 – 140 aa) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | PFN1 (ALS18) |
| Accession Number: | NP_003671.1 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Yang S, et al., Mutation analysis and immunopathological studies of PFN1 in familial and sporadic amyotrophic lateral sclerosis. Neurobiol. Aging 34 (9), 2235 (2013)
Liu H, et al., Expression and regulatory function of miRNA-182 in triple-negative breast cancer cells through its targeting of profilin 1. Tumour Biol. 34 (3), 1713-1722 (2013) Shao J, et al., Phosphorylation of profilin by ROCK1 regulates polyglutamine aggregation. Mol. Cell. Biol. 28 (17), 5196-5208 (2008) |
| Applications: | 1. May be used for in vitro PFN1 protein mediated actin polymerization & AR pathway regulation study with “ProFectin” based intracellular delivery of this protein. 2. May be used for PFN1 protein – protein interaction assay. 3. Potential diagnostic biomarker protein for AR negative related breast cancer. 4. May be used for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY Download Datasheet |