Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1296 | Recombinant Human TULP2 Protein | $300 |
| Product Name: | Recombinant Human TULP2 Protein |
| Catalog #: | HRP-1296 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | As secreted protein, human TULP2 is a member of a family of tubby-like genes (TULPs) that encode proteins of unknown function. Members of this family have been identified in plants, vertebrates, and invertebrates. The TULP proteins share a conserved C-terminal region of approximately 200 amino acid residues. TULP is highly expressed in many tumors and weakly expressed in normal tissues except testis and retina. This protein is a good candidate target for potential cancer vaccine development or used as biomarker protein for early cancer diagnostic applications. Full-length human TULP2 cDNA (2 – 520 aa) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | TULP2 (CT65; TUBL2) |
| Accession Number: | NP_003314 |
| Species: | Human |
| Package Size: | 20 ug / Vial |
| Composition: | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Carroll,K., et al., Tubby proteins: the plot thickens. Nat. Rev. Mol. Cell Biol. 5 (1), 55-63 (2004) Boggon,T.J., et al., Implication of tubby proteins as transcription factors by structure-based functional analysis. Science 286 (5447), 2119-2125 (1999) |
| Applications: | 1. May be used for in vitro TULP2 protein mediated germ cell, embryonic development regulation or tumor cell transformation study with “ProFectin” based intracellular delivery of this protein. 2. May be used for TULP2 protein – protein interaction assay. 3. As Enzymatic substrate for various proteases. 4. Potential diagnostic biomarker protein for various cancer or auto-antigen for various auto-immuno-diseases. 5. May be used for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFSQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANPDASPWLWRSCLREERLLGDRGLGNPFLRKKVSEAHLPSGIHSALGTVSCGGDGRGERGLPTPRTEAVFRNLGLQSPFLSWLPDNSDAELEEVSVENGSVSPPPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASESTGTNSSAAHNEELSKALKGEGGTDSDHMRHEASLAIRSPCPGLEEDMEAYVLRPALPGTMMQCYLTRDKHGVDKGLFPLYYLYLETSDSLQRFLLAGRKRRRSKTSNYLISLDPTHLSRDGDNFVGKVRSNVFSTKFTIFDNGVNPDREHLTRNTARIRQELGAVCYEPNVLGYLGPRKMTVILPGTNSQNQRINVQPLNEQESLLSRYQRGDKQGLLLLHNKTPSWDKENGVYTLNFHGRVTRASVKNFQIVDPKHQEHLVLQFGRVGPDTFTMDFCFPFSPLQAFSICLSSFN Download Datasheet |