Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1242 | Recombinant Human VCAN Ig-like V type domain | $300 |
| Product Name: | Recombinant Human VCAN Ig-like V type domain |
| Catalog #: | HRP-1242 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human versican (VCAN) gene is a member of the aggrecan/versican proteoglycan family. VCAN gene encoded is a large chondroitin sulfate proteoglycan and is a major component of the extracellular matrix. This protein is a hyaluronic acid binding protein, which involved in cell adhesion, proliferation, proliferation, migration and angiogenesis and plays a central role in tissue morphogenesis and maintenance. VCAN contains a Ig-like V type domain, which usually involved in a specific protein-protein interaction. Full-length extracellular Ig-like type V domain of human VCAN cDNA (21 – 146 aa) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | VCAN Ig-like Type V domain (CSPG2; ERVR; GHAP; WGN) |
| Accession Number: | NP_004376 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Yang,W. et al., Versican V2 isoform enhances angiogenesis by regulating endothelial cell activities and fibronectin expression. FEBS Lett. 587 (2), 185-192. (2013).
Li,D., et al., Tumor-produced versican V1 enhances hCAP18/LL-37 expression in macrophages through activation of TLR2 and vitamin D3 signaling to promote ovarian cancer progression in vitro. PLoS ONE 8 (2), E56616 (2013) Potapov V, et al.,"Protein-Protein Recognition: Juxtaposition of Domain and Interface Cores in Immunoglobulins and Other Sandwich-like Proteins". J. Mol. Biol. 342 (2): 665–679. (2004). |
| Applications: | 1. May be used for in vitro non-glycosylated VCAN Ig-like V type domain mediated cell proliferation regulation study with this protein as either coating matrix protein or as soluble factor 2. May be used for VCAN Ig-like V type domain protein – protein interaction assay. 3. Enzymatic substrate for various proteases. 4. May be used for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHENLYFQGGEFLHKVKVGKSPPVRGSLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLT Download Datasheet |