Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-0946 | Recombinant Human DCTN5 Protein | $300 |
| Product Name: | Recombinant Human DCTN5 Protein |
| Catalog #: | HRP-0946 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Dynactin is a multimeric protein essential for the minus-end-directed transport driven by microtubule-based motor dynein. The pointed-end sub-complex in dynactin contains p62, p27, p25, and Arp11 subunits, and is thought to participate in interactions with membranous cargo. Human dynactin subunit 5 (DCTN5) gene encodes a subunit of dynactin (p25), a component of the cytoplasmic dynein motor machinery involved in minus-end-directed transport. The encoded protein is a component of the pointed-end sub-complex and is thought to bind membranous cargo. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Full-length mature protein of human DCTN5 (182 aa, Isoform-I) gene was constructed with 15 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | DCTN5 |
| Accession Number: | NP_115875 |
| Species: | Human |
| Package Size: | 20 µg / Vial |
| Composition: | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Parisi,G., et al., Dynactins p25 and p27 are predicted to adopt the LbetaH fold. FEBS Lett. 562 (1-3), 1-4 (2004)
Olson,J.E., et al., Centrosome-related genes, genetic variation, and risk of breast cancer. Breast Cancer Res. Treat. 125 (1), 221-228 (2011) |
| Applications: | 1. May be used for in vitro DCTN5 mediated dynein motor regulation study for intracellular cargo transportation by intracellular delivery of this protein with “ProFectin” reagent. 2. May be used for mapping DCTN5 protein – protein interaction assay. 3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays. 4. May be used for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV Download Datasheet |