Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1153 | Recombinant Human LGALS7 Protein | $150 |
| Product Name: | Recombinant Human LGALS7 Protein |
| Catalog #: | HRP-1153 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The galectins are a family of b-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that human Galectin-7 (LGALS7) is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. Recent data indicated that LGALS7 is mainly involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release. Full-length mature form of human LGALS7 cDNA (2 – 136 aa, derived from BC061588) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | LGALS7 (GAL7; LGALS7A) |
| Accession Number: | NP_002298 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Takagi,D., et al., Galectin-7 as a marker of cholesteatoma residue and its detection during surgery by an immunofluorescent method--a preliminary study. Otol. Neurotol. 33 (3), 396-399 (2012)
Lee,J.S., et al., EC-SOD induces apoptosis through COX-2 and galectin-7 in the epidermis. J. Dermatol. Sci. 65 (2), 126-133 (2012) Masuyer,G., et al., Inhibition mechanism of human galectin-7 by a novel galactose-benzylphosphate inhibitor. FEBS J. 279 (2), 193-202 (2012) Rondanino,C., et al., Galectin-7 modulates the length of the primary cilia and wound repair in polarized kidney epithelial cells. Am. J. Physiol. Renal Physiol. 301 (3), F622-F633 (2011) |
| Applications: | 1. May be used for in vitro mediated pro-apoptosis pathway regulation study with this protein as either coating matrix protein or soluble factor. 2. May be used as LGALS7 protein-protein interaction assay. 3. As enzymatic substrate for various proteases. 4. Potential cancer biomarker protein for diagnostic and therapeutic development. 5. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF Download Datasheet |