Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-1111 | Recombinant Human CDH15 N-terminal Protein | $150 |
| Product Name: | Recombinant Human CDH15 N-terminal Protein |
| Catalog #: | HRP-1111 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human CDH15 gene is a member of the cadherin superfamily of genes, encoding calcium-dependent intercellular adhesion glycoproteins. Cadherins consist of an extracellular domain containing 5 cadherin domains, a transmembrane region, and a conserved cytoplasmic domain. Transcripts from this particular cadherin are expressed in myoblasts and up-regulated in myotubule-forming cells. The protein is thought to be essential for the control of morphogenetic processes, specifically myogenesis, and may provide a trigger for terminal muscle cell differentiation. N-terminal human CDH15 cDNA, which contains 2 Cadherin domains (61– 246aa, derived from BC008951), was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | CDH15 (CDH14; CDH3; CDHM; MCAD; MRD) |
| Accession Number: | NP_004924 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 2.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Bhalla,K.,et al., Alterations in CDH15 and KIRREL3 in patients with mild to severe intellectual disability. Am. J. Hum. Genet. 83 (6), 703-713 (2008)
Krauss,R.S., et al., Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact. J. Cell. Sci. 118 (PT 11), 2355-2362 (2005) |
| Applications: | 1. May be used for in vitro CDH15 N-termianl mediated myogenesis regulation study with this protein as either coating matrix protein or soluble factor. 2. May be used as CDH15 N-terminal Cadherin domain protein-protein interaction assay. 3. As antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGHHHHHHGNLYFQGGEFLPYPLVQIKSDKQQLGSVIYSIQGPGVDEEPRGVFSIDKFTGKVFLNAMLDREKTDRFRLRAFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQEAFTGRVLEGAVPGTYVTRAEATDADDPETDNAALRFSILQQGSPELFSIDELTGEIRTVQVGLDREVVAVYNLTLQVADMSGDGLTATASAWAHNSRNLVAAALRVVAVAVVVAAVAN Download Datasheet |