Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-0900 | Recombinant Human EIF4E2 Protein | $300 |
| Product Name: | Recombinant Human EIF4E2 Protein |
| Catalog #: | HRP-0900 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Eukaryotic initiation factor 4E (eIF4E) has long been known as the cap-binding protein that participates in recruitment of mRNA to the ribosome. The 7-methylguanosine-containing “cap” plays an essential role at each stage of the mRNA “life cycle”: transcription, splicing, nuclear export, translation, translational repression, and degradation. This is mediated by specific cap-binding proteins, of which at least 10 have been discovered so far. The most widely studied and best understood of these cap-binding proteins is eIF4E, a 25kd cap-binding protein. Full-length mature human EIF4E2 (245 aa) gene was constructed with 15 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies, the final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | EIF4E2 (4E-LP; 4EHP; EIF4EL3; IF4e) |
| Accession Number: | NP_004837 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Morita,M., et al., A novel 4EHP-GIGYF2 translational repressor complex is essential for mammalian development. Mol. Cell. Biol. 32 (17), 3585-3593 (2012)
Rosettani,P., et al., Structures of the human eIF4E homologous protein, h4EHP, in its m7GTP-bound and unliganded forms. J. Mol. Biol. 368 (3), 691-705 (2007) |
| Applications: | 1. May be used for in vitro EIF4E2 mediated mRNA cap binding initiated protein translation regulation study with “ProFectin” based intracellular delivery of this protein. 2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development. 3. May be used for mapping EIF4E2 protein-protein interaction. 4. May be used as antigen for specific antibody production. |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP Download Datasheet |