Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-0889 | Recombinant Human PDCD10 Protein | $300 |
| Product Name: | Recombinant Human PDCD10 Protein |
| Catalog #: | HRP-0889 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human programmed cell death protein 10 (PDCD10) gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular development. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Full-length mature human PDCD10 (212aa) gene was constructed with 17 aa N-terminal T7 tag This protein is expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | PDCD10 (CCM3, TFAR15) |
| Accession Number: | NP_009148 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Fidalgo,M., et al., Adaptor protein cerebral cavernous malformation 3 (CCM3) mediates phosphorylation of the cytoskeletal proteins ezrin/radixin/moesin by mammalian Ste20-4 to protect cells from oxidative stress. J. Biol. Chem. 287 (14), 11556-11565 (2012)
Zhang,H., et al., PDCD10 interacts with STK25 to accelerate cell apoptosis under oxidative stress. Front. Biosci. 17, 2295-2305 (2012) Lin,C., et al., PDCD10/CCM3 acts downstream of {gamma}-protocadherins to regulate neuronal survival. J. Biol. Chem. 285 (53), 41675-41685 (2010) |
| Applications: | 1. May be used for in vitro PDCD10 mediated oxidative stress regulation study with “ProFectin” based intracellular delivery of this protein. 2. As soluble /native protein, may be used as enzymatic substrate protein for kinase or ubiquitin assay development. 3. May be used for mapping PDCD10 protein-protein interaction. 4. As antigen for specific antibody production |
| Quality Control: | Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA Download Datasheet |