Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-0873 | Recombinant Human PSMB7 Protein | $300 |
| Product Name: | Recombinant Human PSMB7 Protein |
| Catalog #: | HRP-0873 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP / ubiquitin-dependent process in a non-lysosomal pathway. Human proteasome subunit beta type-7 proprotein (PSMB7) is a member of the proteasome B-type family, also known as the T1B family, and is a 20S core beta subunit in the proteasome. Expression of this catalytic subunit is down-regulated by gamma interferon, and proteolytic processing is required to generate a mature subunit. Full-length human PSMB7 (277 aa) gene was constructed with 15 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | PSMB7 (Z) |
| Accession Number: | NP_002790 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Krawiec,P., et al., Decreased proteinZ levels in patients with rheumatoid arthritis: links with inflammation. Thromb. Haemost. 106 (3), 548-550 (2011)
Munkacsy,G., et al., PSMB7 is associated with anthracycline resistance and is a prognostic biomarker in breast cancer. Br. J. Cancer 102 (2), 361-368 (2010) Eang,R., et al., Characterization and differential expression of a newly identified phosphorylated isoform of the human 20S proteasome beta7 subunit in tumor vs. normal cell lines. Fundam Clin Pharmacol 23 (2), 215-224 (2009) |
| Applications: | 1. May be used for in vitro PSMB7 mediated protein degradation pathway regulation study with ProFectin based intracellular protein delivery of this protein. 2. As soluble / native protein, may be used as enzymatic substrate protein for kinase or ubiquitin assay development. 3. May be used for mapping PSMB7 protein-protein interaction. 4. May be used as potential diagnostic biomarker for breast cancer anthracycline resistance. 5. May be used as antigen for specific antibody development. |
| Quality Control: | 1. Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS Download Datasheet |