Cata #: | Name of Product: | Price: |
HTF-0045 | Recombinant Human Bmi1-11R Protein | $300 |
Product Name: | Recombinant Human Bmi1-11R Protein |
Catalog #: | HTF-0045 |
Manufacture: | LD Biopharma, Inc. |
Intruduction: | Human Bmi1 (BMI1 polycomb ring finger oncogene) gene is a component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2. This gene was identified as key transcription factor involved in human HSC differentiation. Recombinant human Bmi1 protein was constructed with C-terminal tag of 11 arginine domain, which efficiently delivery protein intracellularly. This protein was expressed in E.coli, refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. Incubating this protein in culture mediums at concentration of 2-8 ug/ml may be used for studying of human HSC cell differentiation or oncogenesis. |
Gene Symbol: | Bmi1 |
Accession Number: | NP_005171 |
Species: | Human |
Package Size: | 50 µg / Vial |
Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
Storage: | In Liquid. Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Key Reference: | Alkema,M.J., et al. Identification of Bmi1-interacting proteins as constituents of a multimeric mammalian polycomb complex. Genes Dev. 11 (2), 226-240 (1997) Hongyan Zhou, et al. Generation of induced pluripotent stem cells using recombinant protein. Cell Stem Cell. Vol 4. Issue 5: 381-384 (2009) |
Applications: | 1. Protein transduction for human HSC cell differentiation. 2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay. 3. As specific protein substrate for kinase assay. 4. Immunogen for specific antibody production. |
Quality Control: | 1. Purity: > 90% by SDS-PAGE. 2.DNA binding activity: to be tested. |
Recombinant Protein Sequence: | 29aa_Tag_HRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG Download Datasheet |