Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-0844 | Recombinant Human GLRX3 Protein | $300 |
| Product Name: | Recombinant Human GLRX3 Protein |
| Catalog #: | HRP-0844 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Human glutaredoxin-3 (GLRX3) gene encodes a member of the glutaredoxin family. Glutaredoxins are oxidoreductase enzymes that reduce a variety of substrates using glutathione as a cofactor. GLRX3 protein binds to and modulates the function of protein kinase C theta. GLRX3 protein may also inhibit apoptosis and play a role in cellular growth, and the expression of this gene may be a marker for cancer. Full-length human GLRX3 (335 aa) gene was constructed with 17 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | GLRX3 (GLRX4; GRX3; GRX4; PICOT; TXNL2; TXNL3) |
| Accession Number: | NP_006532 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Lu,Y., et al., Identification and distribution of thioredoxin-like 2 as the antigen for the monoclonal antibody MC3 specific to colorectal
Cancer. Proteomics 8 (11), 2220-2229 (2008)
Cha,M.K. et al., Preferential overexpression of glutaredoxin3 in human colon and lung carcinoma. Cancer Epidemiol 33 (3-4), 281-287 (2009) Qu,Y., et al., Thioredoxin-like 2 regulates human cancer cell growth and metastasis via redox homeostasis and NF-kappaB signaling. J. Clin. Invest. 121 (1), 212-225 (2011) Cheng,N.H., et al., A mammalian monothiol glutaredoxin, Grx3, is critical for cell cycle progression during embryogenesis. FEBS J. 278 (14), 2525-2539 (2011) |
| Applications: | 1. May be used for in vitro Kinase C pathway regulation study with intracellular delivery of this protein. 2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development. 3. May be used for mapping GLRX3 protein-protein interaction. 4. Potential diagnostic biomarker for various cancers. 5. May be used as antigen for specific antibody development. |
| Quality Control: | 1. Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFGSMAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN Download Datasheet |