Invention in the REGENERATIVE MEDICINE is what we do every day, benefits of patients is our final goal
| Cata #: | Name of Product: | Price: |
| HRP-0837 | Recombinant Human PFDN1 Protein | $300 |
| Product Name: | Recombinant Human PFDN1 Protein |
| Catalog #: | HRP-0837 |
| Manufacture: | LD Biopharma, Inc. |
| Intruduction: | Eukaryotic prefoldin (PFD) is a heterohexameric chaperone with a jellyfish-like structure whose function is to deliver nonnative target proteins, principally actins and tubulins, to the eukaryotic cytosolic chaperonin for facilitated folding. Human Prefolding subunit 1 (PFDN1) gene encodes a member of the prefoldin beta subunit family. The encoded PFDN1 protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. Full-length human PFDN1 (122 aa) gene was constructed with 15 aa N-terminal T7 tag and expressed in E.coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified. |
| Gene Symbol: | PFDN1 (PDF; PFD1) |
| Accession Number: | NP_002613 |
| Species: | Human |
| Package Size: | 50 µg / Vial |
| Composition: | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| Storage: | In Liquid. Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Key Reference: | Gstaiger,M., et al., Control of nutrient-sensitive transcription programs by the unconventional prefoldin URI. Science 302 (5648), 1208-1212 (2003)
Simons,C.T., et al., Selective contribution of eukaryotic prefoldin subunits to actin and tubulin binding. J. Biol. Chem. 279 (6), 4196-4203 (2004) |
| Applications: | 1. May be used for in vitro synthesis protein refolding pathway regulation study with intracellular delivery of this protein. 2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development. 3. May be used for mapping PFDN1 protein-protein interaction. 4. May be used as antigen for specific antibody development. |
| Quality Control: | 1. Purity: > 90% by SDS-PAGE. |
| Recombinant Protein Sequence: | MASMTGGQQMGRGEFMAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ Download Datasheet |